PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022921P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 299aa    MW: 33249.4 Da    PI: 8.6056
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022921P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.13.7e-3273129259
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++++YkeClkNhAas+Gg+a+DGCgEfmps geeg+++al+C+AC+CHRnFHR+e e 
  MELO3C022921P1  73 KHIKYKECLKNHAASMGGNATDGCGEFMPS-GEEGSIEALTCSACNCHRNFHRKEIEG 129
                     5789*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2675130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.0E-2975127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.7E-3276127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.40177126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.8E-20215283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-30218284IPR009057Homeodomain-like
TIGRFAMsTIGR015654.5E-27222278IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MELTTHDPPI PIPIPIPLNS RYAGHNHDHD HIIHHHDPSS TRNHIISATV NGSNNQMEVD  60
LHHHNNNNNN NKKHIKYKEC LKNHAASMGG NATDGCGEFM PSGEEGSIEA LTCSACNCHR  120
NFHRKEIEGE PYDWLHHSRL GRKLLVGGKN MIGPPEPAAF AYPTAGGATF ISSRAATTQP  180
HHMIMSYNML GGGGGHSESE EQEEGIGAGV GGRVYSGAMM NKKRFRTKFT TEQKEKMLRF  240
AEKVGWKIQK QEESVVQQFC QEIGVKRRVL KVWMHNNKHN LAKKETMSPS HSPNNPLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-232232801875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819100.0LN681910.1 Cucumis melo genomic scaffold, anchoredscaffold00056.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460585.10.0PREDICTED: zinc-finger homeodomain protein 4
SwissprotQ9M9S02e-72ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A0A0KSI71e-174A0A0A0KSI7_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s23860.15e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.16e-70homeobox protein 21